PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100154610011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 253aa    MW: 28226.1 Da    PI: 5.6924
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100154610011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.83.3e-12127171145
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45 
                                   +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rq +
  Ote100154610011|100154610011 127 KKRYHRHTPQQIQELESLFKECPHPDEKQRLELSKRLCLETRQTQ 171
                                   688999************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-11110171IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-13113170IPR009057Homeodomain-like
PROSITE profilePS500718.519124172IPR001356Homeobox domain
SMARTSM003890.008125186IPR001356Homeobox domain
PfamPF000468.9E-10127171IPR001356Homeobox domain
CDDcd000862.66E-9127171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MNFGDFLDNN SCSGGGGARI VADLPXXXXX XXXXXXXXXP AGAIVQPRFL SESLSSKPMF  60
NSPGLSLALQ TSMEGQGEMG RMAENNEMSN VGGRRSRDEE HESRSGSDNM DGASGDDLDA  120
ADKPPRKKRY HRHTPQQIQE LESLFKECPH PDEKQRLELS KRLCLETRQT QLERHENSIL  180
RQENDKLRAE NMSIREAMRN PMCTNCGGPA VIGDISLEEQ HLRIENARLK DELDRVCALA  240
GKFLGRPISS SMP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091721.11e-145PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV124e-96ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM1CNN21e-129M1CNN2_SOLTU; Uncharacterized protein
STRINGVIT_15s0048g02000.t011e-128(Vitis vinifera)
STRINGPGSC0003DMT4000713771e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465